PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G185800.1.p
Common NameLOC101773784, SETIT_006865mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 333aa    MW: 36275.9 Da    PI: 8.287
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G185800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-333791155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt eLH+rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Seita.4G185800.1.p 37 KPRLRWTAELHDRFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 91
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-323492IPR009057Homeodomain-like
PROSITE profilePS5129412.4573494IPR017930Myb domain
SuperFamilySSF466896.99E-173693IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-243792IPR006447Myb domain, plants
PfamPF002491.9E-83989IPR001005SANT/Myb domain
PfamPF143792.1E-23127172IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MFPSSKKQPN TGAGSSNDRS MCVQGDSGGL VLTTDPKPRL RWTAELHDRF VDAVAQLGGP  60
DKATPKTIMR VMGVKGLTLY HLKSHLQKFR LGKQHKEFGD HTAMEMQRNV ASSSGVMGRT  120
MNDRSVNVNE ALRIQMEVQR RLHGELEVQK HLQMRVEAQG KYMQSILEKA HQALGTSDYA  180
TWPAGYRSLG NQAVLDIGSS TGFSSLQDLH FYGGSSHMDH LLHQMERPMD SFLTLGENFI  240
GSSSADKKGP NHCSSSGKSS MIWAGEEDQQ VKSGTDQLQM GSSTTMEGGI SVMDPITSLY  300
EGALSGESMG SKGFEGSSSK LEMKSPPHNK HL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9690500.0EU969050.1 Zea mays clone 325800 myb family transcription factor-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700824.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK52e-86APL_ARATH; Myb family transcription factor APL
TrEMBLK3XY570.0K3XY57_SETIT; Uncharacterized protein
STRINGSi006865m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25043890
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-87G2-like family protein